PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_018888-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 211aa    MW: 24387.2 Da    PI: 6.8578
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_018888-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.12.2e-091547133
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgk 33
                     +g W++eEd++l+d++ q+G g+W++++   g+
  AHYPO_018888-RA 15 KGLWSPEEDQRLKDYILQHGIGCWTSVPINAGL 47
                     678************************998884 PP

2Myb_DNA-binding51.32.8e-164994148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg ++t+E+  ++ +++ lG++ W+ Ia++++ gRt++++k++w++yl
  AHYPO_018888-RA 49 RGMFSTQEENMILTLHRTLGNK-WSQIAKHLP-GRTDNEIKNYWHSYL 94
                     788*******************.*********.************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.8661041IPR017877Myb-like domain
SuperFamilySSF466892.38E-191390IPR009057Homeodomain-like
SMARTSM00717481446IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-81442IPR009057Homeodomain-like
PfamPF002492.4E-61546IPR001005SANT/Myb domain
PROSITE profilePS5129422.8884498IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.7E-224497IPR009057Homeodomain-like
SMARTSM007171.3E-144896IPR001005SANT/Myb domain
PfamPF002494.0E-154994IPR001005SANT/Myb domain
CDDcd001673.41E-115294No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MGFKSLDKPL RKHKKGLWSP EEDQRLKDYI LQHGIGCWTS VPINAGLKRG MFSTQEENMI  60
LTLHRTLGNK WSQIAKHLPG RTDNEIKNYW HSYLKKRSLK SVQTVSYTQE NESFLTNNTT  120
KFSRIEHKAL ENAEQIQGQE SFLHRLIFSE WLPTDYNIEG NNGQNLCTEK TVHDDFVQGF  180
GFNEGGSSLS YDGFCHDHNV GDDLAFKFDD Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-1615977107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010667575.11e-73PREDICTED: transcription factor MYB46
SwissprotQ9M0K42e-41LAF1_ARATH; Transcription factor LAF1
TrEMBLA0A0K9RYI94e-78A0A0K9RYI9_SPIOL; Uncharacterized protein
STRINGPGSC0003DMT4000370801e-48(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.11e-42myb domain protein 18